GenomeNet

>ebu:CUC76_15760 K07675 two-component system, NarL family, sensor histidine kinase UhpB [EC:2.7.13.3] | (GenBank) signal transduction histidine-protein kinase/phosphatase UhpB (A)
MKTILPRLLSVIGCAFIFAAAWFCLWSISLHLVERADLAVLLFPFGLRLGLMLQCPRGYW
PVLLGTEWLLIFWLAQEVALAHPIILMTGSLLTLLPVALISRYRQQRDWLTLLRQGGALM
AAALLQSLPWLAEGDEGLNALLLTLTGGLTLAPTCLVFWHYLTSTVWRPLGPSLVAQPVN
WRGRHLIWYLLLFTISLWLQLGLPAELSRFTPFCLALPIIALAWHYGWQGALIATLMNAI
ALIASQTWHDHPVDLLLSLLAQSLTGLLLGAGIQRLRELNQSLQNELARNRRLADRLLET
EESVRRDVARELHDDIGQTITAIRTQAGIVQRLAPDNASVRQSGQLIEHLSLGVYDSVRR
LLGRLRPRQLDDLPLEQAVRSLMREMELEDRGIVSHLDWRINEAGLSENQRVTLFRVCQE
GLNNIVKHASASAVTLQGWQQEERLMLVLEDDGCGLPPGSSAQGFGLTGMRERVTALGGT
LTISCTHGTRVCVNLPLRYA

BLAST