GenomeNet

>eca:ECA4278 no KO assigned | (GenBank) Rhs-family protein (A)
MRDEILARIARVGAMHAGNRPTLPPDLPAPGSGSPPTSPDKPIKHSSFLGALLGAVAGAL
VAAAVAAVAVALVGVTGGLAIALVGGLAVLGAGSLISAVSGRVSAMVDSASPPAGAVADG
SPNVSVEGNPVSRAEVDAVACTKHSGPQLIAQGSETVFVNGHPAARIGDKTVCGATIKEG
ASTVFFGSGQATVLEIQDEFSGWQKALLIAVEFLVPPTRGLFRGLGKLFFRGPKAVMKGL
GAGALWAGKRFKQKTRCATRAFKANKGRARVTQAAKAFKKDPVYIASGEVIENRTDIELG
QTLPLVFERTYRTASSHVGLLGHGWQDSWSEVATVSRDDGDTHVVITLAQGYNIDFTFGV
GTTVVYCAEYPEFKLVRRHNGFHLWHRDSQTWRAFTVRQDDQLLLSAITDNHFNRIDFIR
DPKGYLRKVQHSDGIELLLVWQGEFLRQVQRIDGGQKTVLAEYRQDEQGRLIEADAAHAY
HLFYEYDNHNRLARWHDNDQTWAQYEYDHQGCCIYTTCADGYLTANFEYLADRVVMTDGL
GQRHEYGFNDLYLMTWEKSPLGHITRFEYDDVGNLLREISPAGRMVEFAYLGDSGLVSTF
TDGSGHQWHYDYDDSDRLTSITDPLGRNWVWQYDTKGNPQSLTGPDNSEVHFAWNRYGLL
TEVSDQGGQVQASLFYDHRQRLLSATDAESRTQQLRYDQQDRLTTWTRPDGSTYRLGYRR
ASWKLPEQLLRPDDKQEQRQYDKHNNLLNYTDGNGAVWRQTYGPFDLLTSRTDAEGRTWR
YEYDKESQQLVAVIAPDGNRWQWWLDADARVIREQDMAGTETRYGYDEDGHCISIHNGEG
ETRHFLYDGRGLLIKETAPDDTLHYRYDGAGRLTEVTSATSYIQLSYDVRDRVVQERNSG
TEIRRHYQAESDAVTRSLYWEGEESSAALTSTFRYSATGELRQVQLPDDAELTLAHDAAG
REAARNSNGGFMQQREYDAMGWLTREMSGQQRDGRLQAEQSREHLYDGAGNLTGTRHNRE
AEGYRLDASGRVLTVLSGGTGRTVNTEEEYRYTRTGLPQDATRLTEWQASRLIQRDDTHY
QYDKAGRLIRKQVVQPGYRPQVWHYRWDSRNQLRVVDTPTGERWFYRYDPFGRRTGKRCD
QKAEDIRYLWDGDQIAEVRHYRENQLISRRHWVHNGWELLVQQRQNTDGNWETDFVTSSH
NGEPQAIFNQAGELRWQAPRTNLWGHRTTDNTESLDPGLAFAGQYRDEESGLCYNRFRYY
DPSGGCYISPDPIGIRGGLNLYAYVKNPVNWIDPKGLAGCNIVHRAVTPEQAASIRAGNG
ISRPTPYHRTTPTQHVAGAPHSRDPWISTTRSQSTAEYFATHGGTQAANPIVNIDLSKIP
SDKILDVSNAQKAAEHLQTPFTRNVAAAHQEVLIFGEIPSEAIIGFL

BLAST