GenomeNet

>ecb:100057124 K00006 glycerol-3-phosphate dehydrogenase (NAD+) [EC:1.1.1.8] | (RefSeq) GPD1L; glycerol-3-phosphate dehydrogenase 1-like protein (A)
MAAAPLKVCIVGSGNWGSAVAKIIGNNVKKLQKFASTVKMWVFEETVNGRKLTDIINNDH
ENVKYLPGHKLPENVVAVSNLSEAVQDADLLVFVIPHQFIHRICDEITGRVPKKALGITL
IKGIDEGPEGLKLISDIIREKMGIDISVLMGANIASEVAAEKFCETTIGSKVMENGLLFK
ELLQTPNFRITVVDDADTVELCGALKNIVAVGAGFCDGLHCGDNTKAAVIRLGLMEMIAF
ARIFCKGHVSTATFLESCGVADLITTCYGGRNRRVAEAFARTGKTIEELEKEMLNGQKLQ
GPQTSAEVYRILKQKGLIEKFPLFTAVYQICYEGKPIQEMLLCLQSHPEHR

BLAST