GenomeNet

>ecs:ECs0216 K06887 uncharacterized protein | (RefSeq) Hcp-like protein (A)
MANLIYLTLNGDNQGLISSGCSSQPSIGNKAQTAHIDQIMIYEFMHGLNRDQNVNHHHLT
IKKPIDKASPLLGKAICDNELLTCDFSFYRTNKFGINELFYKIKLTGAKISDIHVSISHI
VVDNSVQPEESVSFSYESIIWEHCSAGTSAYSLWEDRLF

BLAST