GenomeNet

>ecw:EcE24377A_0235 K11894 type VI secretion system protein ImpI | (GenBank) conserved hypothetical protein (A)
MPEEKLQTLSLQVINGSELESGRAARCLFTQQGNVGHAPECHWSVQDRQHSIPAQAFTII
LHDGTFCLRPQTAQLWLNQAKVTATSDLIQLRQGDEIQIGRLMVRVHLNRGDIPHYDEEM
ATPETIVTNRDMLTDTLLSTEGTPHYPGMTHRHQLADTVVNGFSADPLQALQSESLITTG
DPLSGIAAVRPSAPLSDPASNGGINTPFMDLPPIYASPGDRNDDVSAAEMAQRHLAVTPL
LRGLGGSLTMSNSDDADDFLEEAGRTLQAAIKGLLDLQQQRNSLSDKHLRPLEDNPLRLN
MDYATALDVMFAEGKSPVHLAAPAAVSESLRNVRHHEEANRAAIVESLRVLLDAFSPQNL
LRRFVQYRRSHELRQPLDDAGAWQMYSHYYEELASDRQQGFEMLFNEVYAQVYDRVLREK
QREPEA

BLAST