GenomeNet

>eic:NT01EI_0336 no KO assigned | (GenBank) hypothetical protein (A)
MSAGQIPVSGQRLFLGRGFRWTQKHTQRLQDTLRPEVAKYLQPGRLYLAARWLEMKTEHS
APGLGKLLRTDSPLNPVRPLPPVGGNPVLHGIEPDEQDVWLALLERVGHTIVYGTTRVGK
TRLAELLVTQDIRRGEVTIVFDPKGDADLMKRVWAEAHRADRGDALYIFHLGWPEISARY
NAVGRFGRVSEVASRVAGQLSGEGNSAAFREFAWRFVNIIARALVALGERPDYTLIMRYV
NNIADLYIRYAEKVIREQLPSLQAQIQNNEQVLGDDDVPRNMQGQPDAVRIWSIEVALSS
EEGKQLYDPILDGLRSAVRYDRTYFDKIVASLLPLLEKLTTGKTAELLAPDYLEMSDSRP
IFDWEQIIRKKAVVYIGLDALSDSEVASAVGNSMFADLVSVAGHIYKHGIHAGLPGEGES
KVPVNLHCDEFNELMGDEFIPLINKGGGAGMQVTAYTQTSSDIEARIGNAAKTAQVQGNF
NNLIMLRVRENRTAELLTTQLPQVEIYTKTLVSGHQDTDISAGQDFTSSTQDRVGTVKVP
LLEPADVVTLPKGQAFALLEGGQLWKIRMPLPADDADDTLMPQSIAKIAEEMRRNYHSGE
AWWNDAPGIVPAGGVRG

BLAST