GenomeNet

>eko:EKO11_3704 K06887 uncharacterized protein | (GenBank) type VI secretion system effector, Hcp1 family (A)
MANISYLSLSGETQGLISAGCSTLDSVGNKAQPEHKDQIMVYALMHSISRSQNVNHHELI
ITKPVDKSSPLLAKALSDNEKMAICEFILYRTSKAGIYQPYYKINLSKARISSIDFVTPH
AVLEKELEPQERIAFIYEDISWEHTLAGTNAMSKWQDRVQ

BLAST