GenomeNet

>epz:103563547 K08867 WNK lysine deficient protein kinase [EC:2.7.11.1] | (RefSeq) WNK2; WNK lysine deficient protein kinase 2 (A)
ILSPPLPEVLPPAAPELLPQLPGSLAPTAVAAAPSLPVQTTTLLPPAHPPLPSGPGITGP
GPAVQLTVEPALEEQALQDKQPSLLQSCESLGGSDVASGREMSDGGEGAFGGGKLEGRAA
RKHHRRSTRARSRQERTSRPRLTILNVCNTGDKMVECQLETHNHRMVTFKFDLDGDAPDE
IATYMVEHDFILQAERETFIEQMKDVMDKAEDMLSEDTDVDRGSDPGVSPPHVNTCGLGA
GEESRQSQADAPVYQQNVLHTGKRWFIICPVAEHPAAEAPKSSPPLPLSSLQPEASQDSA
PCKDQLSLKDTPGFPAGPQLLSQAGPRDAPGGAPAPLVPSSPPVTTVPQDAATPTASPKP
VPATGSAVQAGGPGTLQGLASERETLQPLAETHDAQPAAQPLGVGRGPCAPPPEPASARE
ASTQGEPLLALAPMPSVPSGGPQPGLGQPLPLLPAAVGAVSLAPTQLPSPPLGPTAPPPP
PSALESDGEGPPPRVGFVDSTIKSLDEKLRTLLYQEHVPTSSASAGTPMEAGDRDFALEP
PRGDRPQVEASGGDAAVPPQPVLEKSETAPARGTTWEQVASSPMTAESSLSSTPAPLGPD
RRLVSDLPTGPSAPQDAPASAIPARLQPTDRSGGVLGETSAEPMQSYLGTMAEGGQASHP
QTHGALASGSPRKWPVQQDGSSPAKTVGRFSVVSTQDEWTLASPHSLRYSAPPDVYLDEA
PHSPDVKLAVRRAQTASSIEVGAGEPVSSDSGDECPRRRPPVQEHASLPGSTGGMASDFM
KKATAFLHRSSRADSPGPETPSRTGVKVPTISVTSFHSQSSYISSDNDSEIEDADIRKEL
QSLREKHLKEISELQSQQKQEIEALYRRLGKPLPPNLGLFHTAPPAGRRRKTSKSKLKAG
KLLNPLVQQLKVVASSTGHLSECSRAPPAKDPAHAGAGPAAAPHPSGKAVQTQQPCSVRA
SLSADFCSGLASDGGGAHGPGWTVSHPTSERVTYKSSSKPRARFLSGPVSVSIWSALKRL
CLGKEHSSRSSTSSLVPGPEPGPQPALHVQAQVNNSNNKKGTFTDDLHKLVDEWTSKTAG
ATQLKPSLNQLKQTQKLHDMEAPAGRLLAPGEARAMNTPRAAVGTPCLAPAPGPLPTAVI
PGATPALPVPMPDSESEKPD

BLAST