GenomeNet

>etc:ETAC_09815 K09810 lipoprotein-releasing system ATP-binding protein [EC:3.6.3.-] | (GenBank) Lipoprotein releasing system ATP-binding protein LolD (A)
MSNPSSRTPALLQCKGLSKSYQEGKLSTDVLRQVSFDIHPGEMMAIVGSSGSGKSTLLHL
LGGLDTPTSGEVIFKGNSLNAMSASAKAALRNRELGFIYQFHHLLPDFNALENVMMPLLI
GGMKPKQAQPQALAMLKAVGLAHRAHHRPSELSGGERQRVAIARALVHNPSLVLADEPTG
NLDMRTADTIFDLLGELNVRQGTAFLVVTHDLALASRLRRQLEMRDGQLTQELTLMETR

BLAST