GenomeNet

>etc:ETAC_15940 K08349 formate dehydrogenase-N, beta subunit | (GenBank) Formate dehydrogenase N beta subunit (A)
MSLQSQDIIKRSATNSLTPPPNGRNHQEEVAKLIDVTTCVGCKACQVGCSEWNDIRDEVG
HCVGVYDNPADLSAKSWTVMRFSEVEENGKLEWLIRKDGCMHCADPGCLKACPSAGAIIQ
YANGIVDFQSEHCIGCGYCIAGCPFNVPRMNPEDKRVYKCTLCVDRVAVGQEPACVKTCP
TGAIHFGTKAAMKTLAAERISELQGRGFADAGLYDPPGVGGTHVMYVLHHADRPELYHGL
PKDPHIDTPITLWKDVLKPVAFAGFIATFIGLLYHYIAVGPNTEDEDDHDDTPRGNAGGQ
EHSQAQGHAEENHHEQK

BLAST