GenomeNet

>etw:ECSP_0222 K11911 type VI secretion system protein VasL | (GenBank) predicted protein (A)
MCIPTRKITRSAVGCSASLVCQTHCTEEAGMNSNVLTQTIVTGSDPRGLPEFSAIREEIN
KASHPSQPELNWKLVESLALAIFKANGVDLHTATYYTLARTRTQGLAGFCEGAELLAAMV
SHDWDKFWPQGGPARTEMLDWFNSRTGNILRQQISFAESDLPLIYRTERALQLICDKLQQ
VELKRVPRVENLLYFMQNTRKRLEPQLKSNTENAAQTTVRTLIYAPETQASSTPEAVVPP
LPGLPEMKVEVRSLTENPPQASVIKQGSTVRGFIAGIACSVAVASALWWWQVYPVQQQLL
QVNDTAQGAATVWMASPELENYERRLQQLLDTSPVQPLETGMQMMRVADSRWPESLQQQQ
ASTQWNEALKTRAQSSPQLRGWLQTRQDLHAFADLVMQREKEGLTLSYIKNVIWQAERGL
GQETPVESLLTQYQDARAQKQNTDALEKQINERLEGVLSRWLLLKNNTIPTIKKALNFNN
IHEYKGVLNGEFNLFNTKW

BLAST