GenomeNet

>eum:ECUMN_0226 K11905 type VI secretion system protein | (RefSeq) hypothetical protein (A)
MQRRDSGPTSSLFERIREAANPPSYQNTKEALIRSIRRNLRQVLNTRSGSCYGSPELGIT
DLNDESLASSDFRREIRKSISQCILHYEPRITDVVVTAAAPDEYAPVELRFHIVATVDVS
ETRGVFEFDILLDNHQRYCVE

BLAST