GenomeNet

>eus:EUTSA_v10006961mg K12818 ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13] | (RefSeq) hypothetical protein (A)
MANLPILQFEEKIVETVEKNPVVVIIGETGSGKSTQLSQILHRRGYTKSGVIAVTQPRRV
AAVSVARRVAQELDVNLGEDVGYAIRFEDRTSSKTRIKYLTDGVLLRESLSNPMLDDYSV
IILDEAHERSLNTDILLGLMKRLVRIRSSNFKVLITSATLDGEKVSEFFSGCPVLNVPGK
LYPVEILYSKERPGSYIESSLKVAIDIHVREPEGDILIFMTGQDDIEKLVSKLEEKVRSL
AEGSCMDAIIYPLHGSLPPEMQVRVFSPPPPNCRRFIVATNIAETSLTVDGVVYVIDSGY
VKQRQYNPSSGMYSLDVIQISKVQANQRAGRAGRTRPGKCYRLYPFAVFRDDFLDATVPE
IQRTSLAGSVLYLKSLDLPDIDILKFDFLDAPSSESLEDALKQLYLIDAIDGNGAITSIG
RTMSELPLEPSLSRTLIEANENGCLSQALTVVAMLSAESNLLPVRSKPNEKKRKHDESNL
PDGSGFGDHIQLLQIFECWDRNNYDTEWCKQNGMQVRGMVFVKDVRRQLCQIMQKISKDR
LEVGARGRNSSSRDDYRKLRKALCVGNANQVAERMLRHNGYRTLSFKPQLMQVHPSSVLS
TDNEGMLPNYVVYHELISTTRPFMRNVCVIEMSWVAPIKRKIEKLNVRKLSGGPANSFKE
PEEKTELSKNNNNAETTPPAVSENVESRIEAARERFLARKGQK

BLAST