GenomeNet

>fab:101814739 K01899 succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5] | (RefSeq) SUCLG1; succinate-CoA ligase alpha subunit (A)
FVLSSLFFPVQQNGVRHCSYTASRKNLYVNKNTKVICQGFTGKQGTFHSQQALDYGTNLV
GGISPGKGGKTHLGLPVFNSVKEAREKTGASATVIYVPPPFAAAAITEAIDAEMPLVVCI
TEGIPQQDMVRVKHRLLRQSKTRLVGPNCPGVINPGECKIGIMPGHIHKKGRIGIVSRSG
TLTYEAVHQTTQVGLGQSICVGIGGDPFNGTNFIDCLDVFLKDPNTEGIILIGEIGGNAE
EDAAAFLKENNSGPNAKPVVSFIAGLTAPPGRRMGHAGAIIAGGKGGAKEKIAALQSAGV
VVSMSPAQLGSTIYKEFEKRKLL

BLAST