GenomeNet

>fca:101086509 K04402 growth arrest and DNA-damage-inducible protein | (RefSeq) GADD45G; growth arrest and DNA damage-inducible protein GADD45 gamma (A)
MTLEEIRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFC
VLAADEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGDEEAASGDLHCI
LISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE

BLAST