GenomeNet

>fca:101087097 K09048 cyclic AMP-responsive element-binding protein 3 | (RefSeq) CREB3L1; cyclic AMP-responsive element-binding protein 3-like protein 1 (A)
MDAVLEPFPADRLFPGSSFLDLGDLNESDFLNNAHFPEHLDHFAENMEDFSNDLFSSFFD
DPVLDEKSPLLDMELDSPTPGIQAEHSYSLSGDSAPQSPLVPIKMEDTTQDVEQEAWVLG
HKLCSVMVKQEQSPELPVDPLAASSAMAAAAAMATTPLLGLSPLSRLPVPHQAPGEMTQL
PVIKAEPQEVNQFLKVTPEDLVQMPLTPPSSHGSDSDGSQSPRSLPPSSPVRPMARSSTA
ISTSPLLTAPHKLQGTSGPLLLTEEEKRTLIAEGYPIPTKLPLTKAEEKALKRVRRKIKN
KISAQESRRKKKEYVECLEKKVETFTSENNELWKKVETLENANRTLLQQLQKLQTLVTNK
ISRPYKMAATQTGTCLMVAALCFVLVLGSLVPCLPEFSSSSQTVKEDPVAADSVYTASQM
PSRSLLFYDEGAGSWEDGRSALLPVEPPDGWEIKPGGPAEQRPQDHLQLDHLDSTHETTK
YLSEAWPKDVGGNGTSPDFSHPKEWFRERDLGPNTTIKLS

BLAST