GenomeNet

>fca:101091299 K05870 cyclic AMP-responsive element-binding protein 1 | (RefSeq) CREB1; cyclic AMP-responsive element-binding protein 1 isoform X3 (A)
MSVNLNSERQFEDAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRL
MKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD

BLAST