GenomeNet

>fca:101094849 K09049 cyclic AMP-dependent transcription factor ATF-6 beta | (RefSeq) ATF6B; cyclic AMP-dependent transcription factor ATF-6 beta isoform X4 (A)
MAGGREGKMAELMLLSEIADPTRFFTDNLLSPEDWGLRNSTLYTGLDDVAEEQTQLFRCP
EQDVPFGSSSLDVGMDVSPPEPPWDPLPIFPDLQVKSEPSSPCSSSSLSSESSRLSTEPS
SQVPAVGEVLVVKTESLAPPLCLLGDDPTSPFETVQINVGPTSDDPSDVQTKLEPVSPSS
SINSEASLLSAESPNQGFIGEEVLEVKTESPSPQGCLLRDVLGPPLGGVQISMGPSSDGS
LGKALPTRKPPLQPKPVVITTVPMPPRAVPPSTTILLQPLVQPPPVSPVVLIQGAIRVQP
EGPAPPAPRPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQG
LEARLQAVLADNQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCIMVFLLFIAFNFG
PVSISDPPPAPISPRMSGEEPRPRRHLLEFSAQEPVHGVEPLQGSSLGPEEPQPSPPGRP
SFRNLTAFPGGSAKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIP
QRAQEKQKSQLWKKSPPVKAVPTQPPGPPERDSAGQLQLYRHPDRSQPEFLDAIDRREDT
FYVVSFRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYEEMMQIECEVMD
TRVIHIKTSTVPPSLRKQPSSTPGNATGGPLPASAAGQARQASHQPLYLNHP

BLAST