GenomeNet

>fca:101095479 K06751 MHC class I antigen | (RefSeq) FLAI-K; saoe class I histocompatibility antigen, A alpha chain-like precursor (A)
MRFLMSRTVLLLLLGALAAPQTWAGSHSLRYFYTAMSRPGLGEPRFIAVGYVDDTQFVRF
DSDAPNPRMEPRAPWVEQVGPEYWDQETRNEKNNAQIFRVDLNTMLRYYNQSESGSHNIQ
WMYGCDVGPDRRFLRGYSQDSYDGKDYIALNEDLRSWTAADTAAQITRRKWEEAGAAEQE
RNYLEGTCVEWLAKYLDMGKETLLRAESPNTRVTRHPISDREVTLRCWALGFYPAEITLT
WQRDGQDHTQDAELVETRPAGDGTFQKWAAVVVSSGEEQRYTCHVQHEGLREPITLRWEP
SSQPSIPILGIIAGVAVLVVIVVVGAVIWRKKFSGGKGPRYSHAARDDSTQGSDSSVMAP
KV

BLAST