GenomeNet

>fca:101100442 K09048 cyclic AMP-responsive element-binding protein 3 | (RefSeq) CREB3L4; cyclic AMP-responsive element-binding protein 3-like protein 4 isoform X2 (A)
MDFRTPDLLDAWLESPEDVFSTGTFPEPGLHGPPPEAPGTKLQEQGLRGWEPSGGRGCGL
RDSEPEDFLKLFIDPNEVYCSGASASSDSGHPSADPGRPDRPPAPQAPSPPALYEVVYEA
GALERTQGEAGPAVGFISLQPGQRSPQLTVPDACVVCELPCDAHDTLPGAGTVNPVPPAT
LLPCQTLFLTEEEKRLLGQEGVSLPAHLPLTKAEERVLKKVRRKIRNKQSAQDSRQRKKE
YIDGLESRAAACSAQNQELQKKVQELERCNVSLVAQLRQLQLLAARTSDKAAQTSTCVVI
LLFSLALIILPSVSPFQGLREAGPEDYQPHGVVSRNILSHKDMTEGLETTVVESRPGGPL
KAKGENGSTRTLLEKMGGKTGSNGHAGAVLHAEEM

BLAST