GenomeNet

>fca:105261262 K09055 CCAAT/enhancer binding protein (C/EBP), alpha | (RefSeq) CEBPA; CCAAT/enhancer-binding protein alpha (A)
MESADFYEAEPRPPMSSHLQSPPHAPSSAAFGFPRGAGSAQPPAPPAAPEPLGGICEHET
SIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAAAPAGAGGGDFDYTGAPGGPGGAAMP
GGTHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPY
QPPPPPPPPHPHPPPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPALGA
AGLPGPGGALKGLAAAHPDLRAGGGGGGGGGAGKVKKSVDKNSNEYRVRRERNNIAVRKS
RDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA

BLAST