GenomeNet

>fln:FLA_4634 K01029 3-oxoacid CoA-transferase subunit B [EC:2.8.3.5] | (GenBank) succinyl-CoA:3-ketoacid-coenzyme A transferase subunit B (A)
MALDKFGIAKRIARELEDGMYVNLGIGIPTLVANYIPEGITVILQSENGILGTGPYPVEE
EVDADLINAGKETVTLLPGGAFFDSAESFGMIRAGKIDLTVLGAMEVSDQGDIANWKIPG
KMVKGMGGAMDLVASARNIIVAMQHTNPKGESKLLPACTLPLTGVACVKKIVTELAVLDV
TSEGFLLREFAPGVTIEEIQQKTLGRLVVGEDVKEMFC

BLAST