GenomeNet

>gga:417712 K09189 histone-lysine N-methyltransferase MLL5 [EC:2.1.1.43] | (RefSeq) KMT2E; inactive histone-lysine N-methyltransferase 2E isoform X1 (A)
MSIVIPLGVDTADTSYLEMAAGSEPESVEASPVVVEKSNSYPHQLYTSSSHSHSYIGLPY
ADHNYGARPPPTPPASPPPSVVISKNEVGIFTTPNFDETSSATTISTSEDGSYGTDITRC
ICGFTHDDGYMICCDKCSVWQHIDCMGIDRQHIPDIYLCERCQPRNLDKERAVLLQRRKR
ENMSDGDTSATESGDEVPVELYTAFQHTPTTFTIASPRVTKVNDKKRKKSGEKEQNIAKC
KKAFREGSRKSSRVKGSAPEIDPTDSSNFGWETKIKAWMDRYEEANNNQYSEGVQREAQK
IALRLGNGNDKKEVSTSNLIFKPPVESYVQKNKKILKAAKDLPPDALIIEYRGKFMLREQ
FEANGYFFKRPYPFVLFYSKFHGLEMCVDARTFGNEARFIRRSCTPNAEVRHVIEDGTIH
LYIYSIHNIPKGAEITIAFDFDYGNCKYKVDCACLKENPECPVLRRSEPTENINTGYETR
RKKGKKEKDVSREKETQNQNITLDCEGAATKMKIADNKQRKLSPLRLSISNNQEPDFIDD
IEEKTPISNEVEMESEEQIAERKRKMTREERKMEAILQAFARLEKREKRREQALERISTA
KTEVKSECKEPQILNDTEFIQEPAKEEAVTKPTPAKVNRAKQRKSFSRSRTHIGQQRRRH
RTVSMCSDIQPSSPDVEVTSQHNETENAALVAEPETETVVTEMVTETEAPALNKCPTKYP
KTKKHLVNEWLSEKSDKTGKPTDSVSERPLRITTDPEVLATQLNSLPGLTYSPHVYSTPK
HYIRFTSPFLSEKRRKKEPVENVTGSCKKRWLKQALEEENSTVIDRFNSPSLEGSRSPAI
NGENKSPLLLNDSCSLTDLTTPLKKRRLYQLLESAFSETSTPTPSPYATPTHADIAASEP
LMFATPPRVKTEDEACRNGYKPIYSPVTPVTPCIHGNTMHFENISSPDSSPEIKRRAYSQ
EGYDRASILALNSFRNSNLTEMGLQEIKTIGYSSPRNRTDVTRQCTGEMESVSDLQLGLE
VIEQSTLHKNLEAPTHDRTDSSSQLETAHCGRGTIYSSWVKSPDRTGVNFSMNSNLRDLT
PSHQLEVGGGFRISESKCLIQDDARGMFMEASVFCTSEDGIASGFGRTVNNDNLMDGNCT
PQNPPQKKKVSLLEYRKRQREARKSGSKTENFPLVTVSPHAAGGGNISSNSGANDGFNNS
GENGEQTDNAASQPVPLPTAVYNAAPEDVGNNGANKETSSSEKNEPEVQWTASTSVEQVR
ERSYHRALLLSDHRKDKDCEPDAENPEPPSECPSPDTSQKTCRSPSKASKPSSPSPVVSA
PSLGKTPTKPDSHWDTAAAAPEAEGVNHPKSELQQKQLTNNVQALSKTHPSQSHLRSSAE
QLSHSQKLPSAPLKLHCPPSPHVENPPKPSTPHAPVQHGYLSPKPHSQQLGSPYRPHHPQ
SPQVGTPQRETHRGFYPTAPTLQPSNQQQASGPLFAQTASGQSSASYSQFNQQNLNSNAP
PPPPPPPPSSTYYQNQQPSGNFQSYSQLKGSIPQQTVFSSGPNQALPGSAGQQTVPGHHV
TAGHFLPSQNPSIHHQASASAAPPPPPPPPAPGPHLVQQQSTHQQHSVAHVVGPVHAVAV
APGSHMHSQAAGHHLPPPPPPPGPMPHHQPPHPPAGHQGLQAQHQHVVNSAPPPPPPPPS
NVIGSGHHPASAQGLHHPSHQGPPHFPSGAHTSVPSYSSQAPHHTTLGPGPQHQPAGTGP
HCQLPGQGPHIQPQGPNSIATPTASGFCPHPGSVTLPHAVQGPQQASPVPGQIPIHRAQV
PPTFQNNYHGSGWH

BLAST