GenomeNet

>gja:107105422 K21852 dedicator of cytokinesis protein 6/7/8 | (RefSeq) DOCK6; dedicator of cytokinesis 6 (A)
MGGILLESVFSARGPRVPQPSGRSFLALALSRLISRTVAAEVRKQVSREYGNSPQLSKKH
GGLPQAVPLTEVVEPVDFEEYVSSHLSEIEPGPLPDLVEXADDLEVLHRPRDCRTLEPGV
PDDGKQDARVRDAVRIYTEDWVMVQRKYQRLSPVGGARAAERQRDRQKELPRQDFELDEA
AQERSGSQGDPDDQKRSSASLDDTPRGSWASSIFDLKNCAADSLLPSLLTRTAIEETDRR
NEEQRKENRHGEILALYPAPDEDEAVERCSVPEVPKEHFGQRILVKCLSLKFEIEIEPIF
GSLALYDVKEKKKISENFYFDLNSEPVKSLLRAHGTHPAISTLARSAVFSLTHPSPDIFL
VIKLEKVLQQGDISECCEPYMVLKETEATKNKEKLEKLRGVAEQFCARLGQYRMPFAWTA
IHLLNIVSSAGLLERETSEPEGERKGTWNERKRKAHERMSVGEETCSFSNFRPATLTVTN
FFKQEADRLSDEDLYKFLADMRRPSSVLRRLRPITALLKIDISPVPENPHYCLSPELLHV
QPYPDLRVRPTKEILEFPVREVYAPHTTYRNLLYVYPQSLNFSSRQGSVRNIAVKLQFMA
GEDPGQALPVIFGKSSCSEFVKEAYTAVVYHNKSPEFYEEFKLKIPANLTDNHHLLFIFY
HVSCQQKQSTPTETPVGYTWIPLMQHGRLRTGQFCLPVSVDKPPPSYSVLTPDVQLPGMK
WVDSHKGVFSVELVAVSSVHTQDPFLDRFFTLTHVLEEYSFPFRLKDVILTESNMEPELK
SSVGNLRVASLEPLVAFSHQVLNKLVQLMVRPPVIGGQTVNMGRAAFEAMAVMVNQIHRS
LEGSHDHHGRSHLLSSYVFYAFHLPVVEPGLADAGLPPPSGPAQSATLSRTSGRPASLNL
SRSKSISNSNPDLATSPDSPEEQAQKVNGSKGIDRSHSWVNSAYAPGGPRNVLRRNHPNS
STDLKQAAGRMPHRLSAYLESSTLAPATLMRPSTKKLLHEELALQWVVSTSAVREAAIHQ
AWFFFQLMVKSMAHHLFLCGKLEAPRKARFPSRFVDDISALVCALSAEIASRCQKDAELV
EHLNGSLAFFLNDLLSLMDRGFVFHLLRSYYKQINNRLLATQNPNTLVALRMDFIRIICS
HEHYVTLNLPCSGLSPPSSPSPSVSSATSQGSAFSSHTQDQRVANMFELSVAFRQQHFLA
GLVLMELALILEPDAEGAFSLHKKAVSALHNLLCSHDSDPRYADSAVRAQVAQLYLPLIG
IVMDALPRLCDCTEIHSQRGRLASVPADEGDGEGGTISPSVAMAIAGSPLPHSHRPSQFQ
MPSVPPRQYSMLSAEVSRTLLVCLLWVLKNADGALLHRWLADLSALQVNRLLDLLYLCVS
CFEYKGKKTLERLNSLTFKKSLDMKARLEEAILGTIGARQEMVRRSRERSPFGNQENVRW
RKNIAHWRQNSDKVDKSRDEVEREALVDGNLATEANMVVLDTLEIVVQTVILSEAKESVL
SGVLRVLLHSMACTPSAAFLQHCFATQRALVSKFPEMLFEEDTELCADLCLRLLRHCSSR
VGTIRAHASASLYLLMRQNFEIGNNFARVKMQVTMSLSSLVGTSPNFNEEHLRRSLKTIL
TYAEEDLELRDTTFAEQVQDLVFNLHMILTDTVKMKEHQEDPEMLIDLMYRIAKGYQASP
DLRLTWLKNMAAKHAERGNHAEAAQCLVHSAALVAEYLSMLEDCPYLPVGCVTFQNISSN
VLEESAVSDDVLSPDEEGICSGKSFTEQGLVGLLEQAASAFTMGGLYEAVNEVYKILTPI
HEANRDFQKLATLHGKLQDAFSKITSQRMFGTYFRVGFYGSKFGDLDEQEFVYKEPSITK
LAEISHRLEEFYAERFGDDMVEIIKDSNPVHKNKLDPNKAYIQLTYVEPFFDTYELKDRI
TYFDKNYNLRTFMFCTPFTLDGRAHGDLHEQFKRKTLLTTSHAFLXXXXPYIRTRINVIR
KEEVILIPIEVAIEDMQKKTQELAFATHQDPADAKMLQMVLQGCVGTTVNQGPLEVAQVF
LAEIPDDPKLYRHHNKLRLSFKDFTKRCEDALRKNKTLIGPDQRDYHRELERNYQRLKEA
LHPLLSRKIPQLYTPIAPYPAHRNSFSRLSLRKMEA

BLAST