GenomeNet

>hals:D7D81_10735 K01879 glycyl-tRNA synthetase beta chain [EC:6.1.1.14] | (GenBank) glycine--tRNA ligase subunit beta (A)
MSRELLFEIGTEELPANYMSTVRKDFKNLTEKTFENKRLVFDDCQVYSTPRRLTLYMKGL
TEKQENKSESLRGPAKSIAFDKAGKPTKAALGFARGQGVDIDELIIRDGYLYLERVIEGK
KTVDILADVFLSIINKMNFPKAMRWGNSTERFIRPIRWLLLLFGEEKIDFSFAGIESDKK
TYGHRFLTDKAITIDNPAEYFSKLEDAYIVVDHNKRKELILKQIKDLSLTEGNVLVDEEL
LSEVIELIEYPTTFFGSFEREYLKLPEEVLTTSMMEHQRYFPVVDKNDNLLPYFVFVRDG
AEEYIDEVRYGNEMVLRARLADARFFYDEDLKLSPVDRREKLKDIVYQEKLGSMYDKVQR
IKSIASKMAVSFELTAEQIDILKRAAELSKNDLVTEMVNEFSKLQGIVGKEYALVNEESR
EVAEAIFEQYLPRYAGDSLPETVYGQIISIADKIDSIVGHFSLGHIPSGSQDPFALRRQA
SGIVKIIIEKDLNLKLDTLISYTFEVMNKQDEKLLQEIKDFLVQRVNNILEEKGIRYDII
KAVIAVNNNDPVDLMDRAEAVMELREDNPALFIDLVRGLVRAKNLASKAEKEYNIDKGLL
KENAELDLYKSYLEFSGEINTMFSQGNYLSGLKRFVELKAAIDNFLDNVIVMVEDEDIKN
NRLALLQKVSALITGVMDIDSIALD

BLAST