GenomeNet

>hch:HCH_04246 K11902 type VI secretion system protein ImpA | (GenBank) uncharacterized protein conserved in bacteria (A)
MASDNIIELEPFFSPISDENPSGTDLRDENDSDFSAAKAARRKVVSLAKAARFDANGELE
LVEQWREIRRLAPTILKRKSKDLEVAAWFTEALLKLEGFTGLRDGLQIIKGLVENFWDTI
YPLPDEDGVETRIYPLISLNGEDGTGTLVLPIKNTPLTDDTENVLTLTSYGRLQDALDIE
DPEERIRRFEELSLSEDIVNQQLLTVSPDKAQNVYEDIQEALALWQEIGELVDAKCAESG
SKASLPTSGVKNALQEVEELYKRLMKNKLLSDDEEAPIQTNDGQSGGNTGGGGGQQMRGG
VAHGPFRSREDAINHLLVVAEYFRKTEPHSPLCGAIERAASWGRMSIQELLMELIPDEEA
RARYALMTGIQIGEDAAPIGQLSQTARAVTIPEPKAKAEGASEPEQGTDNDWNNSGGGGS
GDSSW

BLAST