GenomeNet

>hco:LOKO_02556 K02433 aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7] | (GenBank) gatA_2; Glutamyl-tRNA(Gln) amidotransferase subunit A (A)
MHDKTLVQLARALDAGEFSSRELTQHLLGRIDRLDGELNSFITVTFDQALAAADAADAIR
AKGNAGPLTGLPLALKDIFCTRGVKTSCGSKMLDSFVSPYDATVVEKLRAAGTVSLGKTN
MDEFAMGSSNENSHYGPVHNPWDLTAVPGGSSGGSAAAVAAGLVPAAMGTDTGGSIRQPA
AFCGITGLKPTYGRVSRYGMIAYASSLDQAGPMARTAEDCALLLSAIAGHDLRDSTFVAR
GVPDYSGELTAPLSGLKIGLPREYFGDGLDPAVEKATREAIAVFESLGASVREVSLPHTH
YAIPAYYVIAPAEASSNLSRFDGVRFGHRCDNPADLIDLYKRSRAEGFGDEVKRRILIGT
HTLSEGFFDAYYKKAQQVRRLIRQDFLDAFEEVDVLMGPASPTPAFDLGANKDPVSMYLQ
DIYTIAVNLAGIPGISVPAGFVGDRPVGLQILGSHFTEARLLNVAHQFQQATDWHRRRPA
FAEENA

BLAST