GenomeNet

>hcq:109523950 K03252 translation initiation factor 3 subunit C | (RefSeq) eukaryotic translation initiation factor 3 subunit C (A)
MSRFFATGSDSESEESSSADEIAPKAPGTTLKQSLLLSDDEEDTKRVVRSAKDKRFEELT
NLIKTIRNAMKIRDMAKCLEEFEQLCRAFLKSKNIVDKEGVPPFYIRLLADLEDYLNQLW
EDKEGKKKMNKNNAKALSTLRQKIRKYNRDYETEITAYKENPQESADEEEDKGPDDSGSS
SDSDEDDDGVSAKSFLKKKPEAAPEASKFLKSAKGSGDESSSSDDDEDDEDWGSDTVDTG
SESSDDGEGKSASLAMVFLKKAHAPEKSSEKVGKKKKLKKKEKLEEEAEEEGGEEVEGGW
EKVRGGVPLVKEKPKMFAKGTEINTAVVVKKLHEILQARGKKGTDRTGQIELLHALAAIS
AEHNLGEGVLVKIKFNIIASLYDYNPNMATFMKPEMWKKCLDCIDELLNVLYDNSNMFIG
ENIAEDSENLAISDQPFRVRGCILTLVERMDEEFTKIMQNTDPHSQEYVDNLKDEERVCG
IMDRLLTYLENKGTTEEICRIYLRRIMHTYYKFDYKAHRNSLAMQAETKSQQDQEESEAE
DSAIIMDRLCKFIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIQHAD
PPVQILYNRTMVQLGICAFRQGMIKDAHNALLDIQSSGRAKELLGQGLLMRNMQERNAEQ
EKIEKRRQVPFHMHINLELLECVYLVSAMLLEIPYMAAHEFDARRRMISKQFHHQLRVGE
RQPLLGPPESMREHVVAASKAMKMGDWRTCHSFIINEKMNSKVWDLFPETQRVREMLVRK
IQEESLRTYLFTYSSVYDSISMATLSDMFELEIATVHSIISKMIINEELMASLDQPTQTV
VMHRTEPTSLQNMALQLAEKLGSLVENNERVFDLKQGVYGGYFNRDQKGGYQQKQSYQRD
GGKGGYQSKQGGYQRGGYRNQNQGNY

BLAST