GenomeNet

>hcq:109524800 K00940 nucleoside-diphosphate kinase [EC:2.7.4.6] | (RefSeq) nucleoside diphosphate kinase A2-like (A)
MAEQKERTFIAIKPDGVQRGIIGEVITRFERKGFKLAAMKMLQASEDLLMEHYSDLKERP
FFPHLVNFMSSGPVVAMVWEGKGVVKTGRVMLGETNPADSKPGTIRGDFCIDVSKNIIHG
SDSVESATKEIALWFKQEELTSYTSCASSWIY

BLAST