GenomeNet

>hde:HDEF_2043 K00627 pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12] | (GenBank) aceF; pyruvate dehydrogenase, dihydrolipoyltransacetylase subunit (A)
MVIEIKMPDIGTDTPEVIEIMVKVGDVVVPEQTLLCVEGDKASMDIPSPQEGTIKEIKVS
VGDKVETGKLIMLFESSTEAVPEKKGKTQVPAPAIPAQENTKTVSLPDVGSDELEVTEIL
VKVGDSVTEEQSLITVEGDKASMEVPAPFSGTVKEIQIKTGDKVKTGSMIMIMNTIEKIT
PAPDQKIQKTADALPEQKPEIPPSKPSAPSNTTTSIEKTTPSFTEEAYTHATPVIRRLAR
ELGVNLEKVAGTGRKGRILKEDVQSYVKNAVQTAESASSGQGNLTPLLPWPKIDFNQFGE
TEEIALTRIQKMSGDNLSRNWVMIPHVTQFDETDITDLEDFRKKQNIEAEKRKLDVKITP
VVFMMKAVAQALKTFPRFNSSLSLDGKKLILKKYINIGVAVDTPNGLVVPVFRDVNKKGV
IELSKELMLISQKARSGKLTASDMQGGCFTISSLGGIGGTAFTPIVNAPEVAILGVSKSA
IKPIWNGKEFLPRLMLPLSLSFDHRVIDGAAGARFVSHISVIMADIRRLIM

BLAST