GenomeNet

>hha:Hhal_0158 K11905 type VI secretion system protein | (GenBank) protein of unknown function DUF1316 (A)
MTVGLFDRLEGGTGRPPPHTGTMPGSESRASVVRHILRLLAARRGRPAHLAGYGLPDLSS
YYHDLDGAAACLATAAQELIPRYEPRVVSLAVHAQPASVETGYVLWLALRAQLHRGKHLT
LELAVDGNAGVHLLSGGGDGSASGV

BLAST