GenomeNet

>hro:HELRODRAFT_181703 K03103 multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80] | (RefSeq) hypothetical protein (A)
MSNEISIFILFIFCGQLHLSEENLYRLGTKTHYNLSHEIDKHDKFTQLAPGDNFLPSDKF
LHMYGNFRHGSRYPGKKDVVNGLNITEKLKNLNFPSDKYQEMHYVIQDMKNTEHSKLSPS
GKQEHRDIGRKYGGIFKDLNFGKIDPSNTVFGHSNVSRAMESMEGFMETFLPVVDPKSKN
NAYKRENKRSLLRFFEFCTEYINTVKNNKTMGEEKNTFMNNNREKLLSYIKEKAYWEKGP
GVKINYAMSCGVIKEIFGIYDEILAKKSKEIARFYFSHAETLIPLLNIIGLFRGDPPLKH
NTFEANKNREFKTTRVSPFATNFVFVLMEREKTAYIRLYFKGEPYQFSFCKSSICEYSKN
PSDRRNNYVEHGTLKFLNMICCLGIISYILI

BLAST