GenomeNet

>hro:HELRODRAFT_181936 K00232 acyl-CoA oxidase [EC:1.3.3.6] | (RefSeq) hypothetical protein (A)
MAQLITDGSNHGVHPFVCQLRDVDTHLPLSGIELGDIGTKQGWNGIDNGYLRLDNVRVPR
TNMLMKYFVVHKDGRYERIGSNDKAIYSTLIYARSLCASFYGGRMVIMAASVAIRHCLVM
KCDKYGSLFENRFVKNTLVTELASGLAIWLAGNALSNEYKRLLPRIMDGDSSPLPALHAI
SSGYKALSTYLGPEGVERCRRCCGQVGGLVASGLPIISETVSPGVTIDGDNTVMYLQLAR
YLVKLERRRREDGDSKNERGDDVDNEFDSSGPNSKSFALHMIKLHGLKSQKLIEQAYDRM
TSLVTSEGLPLYEAWNRTSVDLVQAAEAYTISYAVKSFYDVIMSCGNDQDGGPDRDDEDL
KNVLFDVLCLFAVHSFVSSVNVCYHLLTDKLPTSNLSDLRQSIDKMVDKLAPNALALSDG
LDLSDAELDTCIGTYCGNTDADIFNYVADVQPYNAKPDLLKPVLEGLRNYFKLRSRL

BLAST