GenomeNet

>hsa:115761 K07959 ADP-ribosylation factor-like protein 11 | (RefSeq) ARL11, ARLTS1; ADP ribosylation factor like GTPase 11 (A)
MGSVNSRGHKAEAQVVMMGLDSAGKTTLLYKLKGHQLVETLPTVGFNVEPLKAPGHVSLT
LWDVGGQAPLRASWKDYLEGTDILVYVLDSTDEARLPESAAELTEVLNDPNMAGVPFLVL
ANKQEAPDALPLLKIRNRLSLERFQDHCWELRGCSALTGEGLPEALQSLWSLLKSRSCMC
LQARAHGAERGDSKRS

BLAST