GenomeNet

>hsa:203260 no KO assigned | (RefSeq) CCDC107, PSEC0222; coiled-coil domain containing 107 (A)
MAGAVSLLGVVGLLLVSALSGVLGDRANPDLRAHPGNAAHPGSGATEPRRRPPLKDQRER
TRAGSLPLGALYTAAVAAFVLYKCLQGKDETAVLHEEASKQQPLQSEQQLAQLTQQLAQT
EQHLNNLMAQLDPLFERVTTLAGAQQELLNMKLWTIHELLQDSKPDKDMEASEPGEGSGG
ESAGGGDKVSETGTFLISPHTEASRPLPEDFCLKEDEEEIGDSQAWEEPTNWSTETWNLA
TSWEVGRGLRRRCSQAVAKGPSHSLGWEGGTTAEGRLKQSLFS

BLAST