GenomeNet

>hsa:5565 K07199 5'-AMP-activated protein kinase, regulatory beta subunit | (RefSeq) PRKAB2; protein kinase AMP-activated non-catalytic subunit beta 2 (A)
MGNTTSDRVSGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFV
SWQQDLEDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPE
GEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRD
LSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNH
LYALSIKDSVMVLSATHRYKKKYVTTLLYKPI

BLAST