GenomeNet

>hsa:79643 K12195 charged multivesicular body protein 6 | (RefSeq) CHMP6, VPS20; charged multivesicular body protein 6 (A)
MGNLFGRKKQSRVTEQDKAILQLKQQRDKLRQYQKRIAQQLERERALARQLLRDGRKERA
KLLLKKKRYQEQLLDRTENQISSLEAMVQSIEFTQIEMKVMEGLQFGNECLNKMHQVMSI
EEVERILDETQEAVEYQRQIDELLAGSFTQEDEDAILEELSAITQEQIELPEVPSEPLPE
KIPENVPVKARPRQAELVAAS

BLAST