GenomeNet

>hsa:84320 no KO assigned | (RefSeq) ACBD6; acyl-CoA binding domain containing 6 (A)
MASSFLPAGAITGDSGGELSSGDDSGEVEFPHSPEIEETSCLAELFEKAAAHLQGLIQVA
SREQLLYLYARYKQVKVGNCNTPKPSFFDFEGKQKWEAWKALGDSSPSQAMQEYIAVVKK
LDPGWNPQIPEKKGKEANTGFGGPVISSLYHEETIREEDKNIFDYCRENNIDHITKAIKS
KNVDVNVKDEEGRALLHWACDRGHKELVTVLLQHRADINCQDNEGQTALHYASACEFLDI
VELLLQSGADPTLRDQDGCLPEEVTGCKTVSLVLQRHTTGKA

BLAST