GenomeNet

>hse:Hsero_3281 K07053 3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97] | (GenBank) PHP family metal-dependent phosphoesterase protein (A)
MSMSELKFDLHCHSNVSDGLLPPEQVAARAKANGVGVWALTDHDEIDGVARARAAAQALG
MVHVGGVEISVTWAGHTVHIVGLQIDETNPALVQGLAATRNGRERRAREIAAQLEQHGVA
GAYEGALKHVGNPDLISRTHFARFMVECGRCCDTREVFANYLTEGKPGYVPHRWATLEEA
VRWIRGAGGVAVIAHPGRYKYSETQFGAFFDEFRQLGGAAIEVNTGSHTPEQYQQYAQVA
RHYGFLASMGSDFHGPGESRVDLGGLPPLPQGVKPVWHDWAL

BLAST