GenomeNet

>hso:HS_1776 no KO assigned | (GenBank) conserved hypothetical protein (A)
MIKRTLLFCLGISISAWAELPSEVNITVFSTQAYPIQNAQLAHRLYHLDSVEQWEEQLSQ
TLSANPAQAENQAKAFFQHPDSQTKIRELQQAYQGVILGWQMGIRKVPAVLFDSPQLGQA
VVYGVTDVQQAITFWEQWISQKGEK

BLAST