GenomeNet

>hyl:LPB072_04095 no KO assigned | (GenBank) hypothetical protein (A)
MKTRVAGCAASLVILLSACGGGTGDKPVPERSTVQQAGASTESPLSTEALLALGARLNTS
ALKEAESEALAADQLGARTGLDQLAPGEQAPWSAYASGAVREKAADKLVPVWRFYNGATG
AHFFTRNATERDNVIANLSPPKGSFQYEGEAFKVANAPSPGLSPVHRFYNTQTGVHFYTI
SDTERTHITTNLPQFAYEGIAYYASKVNGGGMTPFYRFYLPGKGFHFYTASLQERDNIIA
NLAAIYQYEGAGYSVLQSNWQPEPEPPAVVPHSGMKDTQCVAFGSFGSYVSCADPNAQAL
NPQQDGHRANTNPMSYSAIGAYPTTSCVKDNVTGLIWEGKTANNEPRGGGTVYTNYPFGY
GKTDDASGYITYVNGLNLCGYSDWRLPTRTELLGIVDFGRYEPALDSAWFPNSNHTYWTA
DKLGWDNGYSATVTFTSGYTGAASASKERIRLVRGYGHTTQRYSYGTVAYGSDATNNVVI
DGWTGLRWRRCEQGRTWTGATCSGTASTLTHYDALTHARDLTGWRLPNVKELASLVSLGV
ASGTTIDSTAFPGAAAANLWSSTPWDLLGRARYVGFADGRVSASPHNTAYPVRLVQLIP

BLAST