GenomeNet

>jaz:YQ44_23695 K06195 ApaG protein | (GenBank) magnesium transporter ApaG (A)
MATYEFTVTVKTQYLPEQSAPEQGRHVFSYTIRVVNTGTVGAQLISRHWVITDANDKVEE
VRGLGAVGHQPLLQPGEQFEYTSGTMLATPQGSMRGEYFCVAEDGHQFVAAIPEFVLSLP
RTLH

BLAST