GenomeNet

>kla:KLLA0_A09647g K01874 methionyl-tRNA synthetase [EC:6.1.1.10] | (RefSeq) uncharacterized protein (A)
MTNIRRNGDRFTTKRATDTLRPISLAMASSHISFDQSKGHTSALQLANNIKLAYALLSSG
NLKLEENKDVLIPQLVIDSTGFRLFDANAILRYVLNDFEEEESNEYNFAVSSLEAFASHK
DPIKEHLAEAVQKSLDNYLTSVEEPLSATRIVIFANTYALDPAAVEARITSLPERLQEAL
KLAKTKIVRSSTDYKHTGAVNVSQEHLMKSQDAEILPKEGERNILITSALPYVNNVPHLG
NIVGSVLSADIYSRFAKGRNYNALYICGTDEYGTATETKALEDGVTPRELCDKYHKVHSD
VYKWFQIGFDYFGRTTTEKQTAIAQDIFMKLYDRGFLEEQTMKQLYCPAHKGYLADRYVE
GTCPKCGYEDARGDQCDKCGALLNPFELIDPRCKLDDGVPEPRDSDHIFMSLDKLEPEIK
KWVDEASSKGNWSKNSKTITQSWLKEGLHPRCITRDLVWGTPVPLENYKEKVLYVWFDAC
IGYVSITANYTNKWEQWWKNPNNIDLYQFMGKDNVPFHTVIFPGSQLGTGDDWTMLHHLN
TTEYLQYEGGKFSKSRSIGVFGNNAQEIGLSPSVWRYYLISVRPETSDSQFSWSDFAARN
NSELLANLGNFVNRVVKFVNAKYNGVVPDFNVDNLPGYAQLKKDIDEILTNYVDNMEKVH
LRRGLEIAMTLSARGNQFLQDNKLDNSLFAQEPAKSDAVVGVALNIIYTVASIMSPFIPE
TSEIIYRMLNAPALRIDDHFNLPIRPGHNINKAEYLFSRIDEKDVEKWRSKHSGKQV

BLAST