GenomeNet

>kpnu:LI86_22615 K01571 oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2] | (GenBank) oxaloacetate decarboxylase (A)
MTVAITDVVLRDAHQSLFATRLRLDDMLPVAAQLDDVGYRSLECWGGATFDACIRFLGED
PWVRLRELKKAMPKTPLQMLLRGQNLLGYRHYADDVVERFVERAVKNGMDVFRVFDAMND
PRNMQPALQAVRRHGAHAQGTLSYTTSPAHTLQTWLDLTEQLLETGVDSVAIKDMSGILT
PHAAFELVSEIKKRYDVTLHLHCHATTGMAEMALLKAIEAGVDGVDTAISSMSATYGHPA
TEALVATLAGTPYDTGLDIHRLESIAAYFREVRKKYHAFEGQLKGTDSRILVAQVPGGML
TNLEGQLKQQSAAHRLDEVLAEIPRVREDLGFIPLVTPTSQIVGTQAVLNVLGGERYKTI
AKETAGILKGEYGRTPAPVNAALQARVLDGADPVTCRPADLLKPELAQLEADVKRQAQEK
GITLAENAIDDVLTVALFPQPGLKFLENRHNPAAFEPVPQAEAAQPVAKAEKPAASGVYT
VEVEGKAFVVKVSDGGDVSQLTAAAPAPAPAPASAPAAAAPAGAGTPVTAPLAGTIWKVL
ASEGQTVAAGEVLLILEAMKMETEIRAAQAGTVRGIAVKAGDAVAVGDTLMTLA

BLAST