GenomeNet

>kpu:KP1_0616 no KO assigned | (GenBank) conserved hypothetical protein (A)
MMPRQSLLLKILLPVIVFLTVWLLLRPADKSTPEKSPSRTVAALTPQELRELGIDGDTPA
DTIATLVGQMKQYRRELQSIQSDNESQQAREKRLKAQQATLASELRGDMRRQQDQMRDGL
LKSQRGLLDKLDRLMAKRPDDIPPGLGLTPGELPADVQPDIRWLEPLDAPPPVDEKLLRV
PLKAADKPPPKPDVKVYTLPQNATLTGSVAMTALIGRVPLNGTVSDPYPFKLLIGEDNLT
ANGIELPDVAGAVVSGIASGDWTLSCVRGQITSMTFVFHDGTIRTVPQGGKSGNKQQEIG
WLSDNQGLPCIPGERKSNAKEYLTSQFLLAGSGAAAQAFANGESTTVVEDGSITSAVTGN
NGQYVLGQAIGGGLKETADWMKQHYGQMFDAVYVPPGHKVAVHLTEALAIDYEPEGRKVK
YQQASTPEGLE

BLAST