GenomeNet

>lag:N175_11685 K00940 nucleoside-diphosphate kinase [EC:2.7.4.6] | (GenBank) ndk; nucleoside diphosphate kinase (A)
MALERTFSIIKPDAVERNLIGEIYHRIEKSGLRIIAAKMVHLNEEQASGFYAEHEGKAFF
PALKEFMTSGPIMAQVLEGEDAIARYRELMGKTNPEEAACGTIRADYALSMRHNSVHGSD
SPESAAREIAFFFPESEIFSR

BLAST