GenomeNet

>las:CLIBASIA_04860 no KO assigned | (GenBank) hypothetical protein (A)
MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNPK

BLAST