GenomeNet

>lcw:BN194_22190 K03581 exodeoxyribonuclease V alpha subunit [EC:3.1.11.5] | (GenBank) recD; Putative exodeoxyribonuclease V (A)
MRTALKMTLTQEATITGDMGYYNRRAIITADLVYDDAGSLRYNKPSYKLARLHFGLPKEP
RRQWQLIDTLLVHQPTVRRRLHEHFADDTPILTIFSTDQVKPDSVPGIGPATIKKIATAI
RGKLEIAVLANHWGKALSSMTYEKIWLAYKDANLAMQSIDANPYLLMSVAQLDFKKVDTF
AKTRGIAANDPHRLTAGLQYIFRTAVLTQGLTYITITWFRQQAATLLAVREADLKMFADP
QEALQYGFLLNEQYGLVTSCDMFATEGSVARIIKVAQKTAEPLMAPDELDDALDQFLDRF
HLTINDQQRAAFQNVNRHGLSVLNGSAGTGKTWLTDLLVRFFNAQAKGKSVLLAPTGRAA
KVLAKYTHEPAATIHAYLHLLPGEETGQFDADADWETFGDARLIVVDESSMLTTPLAYTV
LKNVNFKKAHVLFVGDVFQLPPIGPGNFLKDCLDDEQVAATTLTRVYRQDSQSGVLALAN
RIRERLALPFGPDDDRYVSGNVALCNQRNAGRVFDAGVKAYQDALVKSGQQIDAQLLIVN
KNIGATGRLRFNAELQALVNPAKNGEPEYISSYVDPVTNQKHHLRLNDRVMILKNDKHVP
LVDPKTWERRAVLGENGLQQTDDFGTKRWRETIVANGDTGVVAHIDTKRHFVVVQIGQQY
CYYSFGSVPRDLTLAYAITVHKAQGGQADTVIAIVNGADMMLNAQSFYTALTRTQQQFIF
FGDFRVLLARTKIYPIDARHDLLGSFLSGQLTVDTFSRYTFDQVLAWLDKRHAERLSTRP
ALEAEEVKPSEQPFSVRYAEQLDILDQIVDEVAQLPARKPARDV

BLAST