GenomeNet

>lgc:A9176_01265 K00925 acetate kinase [EC:2.7.2.1] | (GenBank) acetate kinase (A)
MAKTMAVNAGSSSLKFQLLEMPAEQVLAQGLIERIGMDDAIVTIKYDAKAMNQGGRLDDQ
SVDDSNITISKDGQTRKYETVLPIKDHQQAINFMLQKLTDLGIIVDFNEITGVGHRVVAG
GEWFNHSVKVTKAVLEKIDRLADYAPLHNPANAMGIRAFQKLLPDAVSVAVFDTSFYQTM
PEENYLYAIPYQYYTRYGARKYGAHGTSHRYVANRAADMLRQPLKDLKVITMHLGAGDSI
TAVKDGKALDTSMGFTPLAGVAMATRSGDVDTSLIYYIQEREGLTNDQMLNILNKKSGLL
GLSTISSDMRDLLAVYDTNDHARLAIKVFVNRIVKYVGQYIAEMGGVDALVFTAGIGENS
APIRQMIADKLAYFGVALDEAANQKRGEEIDISAKDARVKTLVIPTNEELMIARDVELFK

BLAST