GenomeNet

>lgr:LCGT_0957 K14188 D-alanine--poly(phosphoribitol) ligase subunit 2 [EC:6.1.1.13] | (GenBank) D-alanyl carrier protein (A)
MKNEVLNIIEEVAGTDEFREDLDMDLFEEGILDSMRAIMLIVELENAFSLSLPPSEMDRD
DWNTANKITDRIKEKMDEER

BLAST